PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AS_03A679D8F.1
Common NameNFYC-B6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YC
Protein Properties Length: 67aa    MW: 7506.93 Da    PI: 10.7105
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AS_03A679D8F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC46.86.4e-157631975
                  NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlk 75
                           +++P arikki++adedv +i+  +Pvl+s+a elf+ +l   s+  + ++  +tl+
  Traes_4AS_03A679D8F.1  7 TRFPAARIKKIMQADEDVGKIALAVPVLVSRALELFLQDLIDHSYKITLQSGAKTLN 63
                           679******************************************999999999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.19E-15367IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.2E-24367IPR009072Histone-fold
PfamPF008083.3E-17867IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MRKKLGTRFP AARIKKIMQA DEDVGKIALA VPVLVSRALE LFLQDLIDHS YKITLQSGAK  60
TLNSFHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-22267570Transcription Regulator NC2 alpha chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787301e-108KM078730.1 Triticum aestivum CCAAT-binding transcription factor C (NFYC-B6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449647.12e-38hypothetical protein SORBIDRAFT_05g020860
RefseqXP_004979427.12e-38PREDICTED: dr1-associated corepressor-like
TrEMBLA0A0A7LUP09e-41A0A0A7LUP0_WHEAT; CCAAT-binding transcription factor C
TrEMBLW5DVT82e-42W5DVT8_WHEAT; Uncharacterized protein
STRINGMLOC_11547.23e-39(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21723679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.17e-35nuclear factor Y, subunit C11
Publications ? help Back to Top
  1. Qu B, et al.
    A wheat CCAAT box-binding transcription factor increases the grain yield of wheat with less fertilizer input.
    Plant Physiol., 2015. 167(2): p. 411-23
    [PMID:25489021]